PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_1542_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 277aa    MW: 31368 Da    PI: 9.5035
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_1542_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.22.2e-092470246
                                         SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                                          rWT+eE +++  a ++   +   +W+++a++++ g++  ++++ +  
  cra_locus_1542_iso_4_len_1611_ver_3 24 SRWTEEENKQFESALALIDERrpdRWDKVAEMIP-GKSVSDVINQYKE 70
                                         69********************************.*********9975 PP

2Myb_DNA-binding39.21.7e-12124168347
                                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          +WT++E+ +++ + + +G+g+W+ I+r +   +t+ q+ s+ qky
  cra_locus_1542_iso_4_len_1611_ver_3 124 PWTEDEHRRFLLGLQAHGKGDWRNISRNFVRSKTPTQVASHAQKY 168
                                          7*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-41571IPR009057Homeodomain-like
PROSITE profilePS512937.4642175IPR017884SANT domain
SMARTSM007178.4E-102274IPR001005SANT/Myb domain
SuperFamilySSF466893.66E-112479IPR009057Homeodomain-like
PfamPF002493.1E-82570IPR001005SANT/Myb domain
CDDcd001678.77E-82572No hitNo description
Gene3DG3DSA:1.10.10.608.3E-10115173IPR009057Homeodomain-like
PROSITE profilePS5129416.379116173IPR017930Myb domain
SuperFamilySSF466892.76E-16119172IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-17120172IPR006447Myb domain, plants
SMARTSM007172.9E-9121171IPR001005SANT/Myb domain
PfamPF002497.7E-10124168IPR001005SANT/Myb domain
CDDcd001671.70E-8124169No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MATLYPPSSY MGNSNWILPQ NKSSRWTEEE NKQFESALAL IDERRPDRWD KVAEMIPGKS  60
VSDVINQYKE LVADVSNIEA GLFPSPAGYL APSSSLELME NRRFDSFIRK RGRTCDQERK  120
KGIPWTEDEH RRFLLGLQAH GKGDWRNISR NFVRSKTPTQ VASHAQKYFL RQLSGGKDKK  180
RPSIHDITTV HLPNTSPSDD NKSPNSSDKS APSASSKLLL DWNNSNDGLL MVFDSNHGNE  240
SMESLFDIAS RGHRYAANIC TTANSRFHIQ PTKYVHG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1108120RKRGRTCDQERKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002275014.11e-113PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H78e-82DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A068V2E51e-141A0A068V2E5_COFCA; Uncharacterized protein
STRINGVIT_13s0019g03370.t011e-112(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140